Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNG2 Rabbit Polyclonal Antibody (HRP)

CCNG2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q16589

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CCNG2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNT

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_004345

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUMF1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B10]
TA800632AM 100 µL

SUMF1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B10]

Sign In for Pricing
View Details
Human VE-Cadherin Antibody Pair Set
E-KAB-0277 50 µL & 100 µg

Human VE-Cadherin Antibody Pair Set

Sign In for Pricing
View Details
Lactoferrin Antibody
KC-513-01 50 μL

Lactoferrin Antibody

Sign In for Pricing
View Details
Lactoferrin Antibody
KC-513-02 100 µL

Lactoferrin Antibody

Sign In for Pricing
View Details
Lactoferrin Antibody
KC-513-03 1 mL

Lactoferrin Antibody

Sign In for Pricing
View Details
Human FAM83B activation kit by CRISPRa
GA116674 1 Kit

Human FAM83B activation kit by CRISPRa

Sign In for Pricing
View Details