Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC25C Rabbit Polyclonal Antibody (HRP)

CDC25C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CDC25, PPP1R60

UniProt

P30307

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CDC25C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALRE

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_073720

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM5C ORF Vector (Human) (pORF)
ORF019361 1.0 µg DNA

FAM5C ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
TMPRSS4 Protein Vector (Rat) (pPM-C-His)
PV311961 500 ng

TMPRSS4 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
GFAP Antibody
orb2656206-01 20 µg

GFAP Antibody

Sign In for Pricing
View Details
GFAP Antibody
orb2656206-02 100 µg

GFAP Antibody

Sign In for Pricing
View Details
GFAP Antibody
orb2656206-03 100 ug (without BSA and Azide)

GFAP Antibody

Sign In for Pricing
View Details
Bpnt1 3'UTR Luciferase Stable Cell Line
TU102826 1.0 mL

Bpnt1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details