Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CUL2 Rabbit Polyclonal Antibody (Biotin)

CUL2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q13617

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CUL2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

81 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_003582

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRP2 Protein Lysate (Mouse) with C-HA Tag
32180035 100 µg

NRP2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Bglap2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
13307064 1.0 µg DNA

Bglap2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Bsx Protein Lysate (Human) with C-Ha Tag
13512031 100 µg

Bsx Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Nectin4 Mouse shRNA Lentiviral Particle (Locus ID 71740)
TL510388V 500 µL Each

Nectin4 Mouse shRNA Lentiviral Particle (Locus ID 71740)

Sign In for Pricing
View Details
Human Zinc finger protein ZFPM1, ZFPM1 ELISA KIT
ELI-09887h 96 Tests

Human Zinc finger protein ZFPM1, ZFPM1 ELISA KIT

Sign In for Pricing
View Details
Desmin Antibody
MBS9435582-01 0.05 mL

Desmin Antibody

Sign In for Pricing
View Details