Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CUL2 Rabbit Polyclonal Antibody (HRP)

CUL2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q13617

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CUL2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

81 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_003582

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Urokinase Plasminogen Activator Surface Receptor (Monocyte Activation Antigen Mo3, CD87, U-PAR, PLAUR, uPA Receptor) discontinued
215507 100 µg

Urokinase Plasminogen Activator Surface Receptor (Monocyte Activation Antigen Mo3, CD87, U-PAR, PLAUR, uPA Receptor) discontinued

Sign In for Pricing
View Details
SHC1 Antibody, HRP conjugated
CSB-PA021253LB01HU-01 50 µg

SHC1 Antibody, HRP conjugated

Sign In for Pricing
View Details
SHC1 Antibody, HRP conjugated
CSB-PA021253LB01HU-02 100 µg

SHC1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Human Heat shock-related 70 kDa protein 2 ELISA Kit
EK5081 Inquire

Human Heat shock-related 70 kDa protein 2 ELISA Kit

Sign In for Pricing
View Details
Cytokeratin 17 Monoclonal Antibody
BT-MCA0421-01 50 µL

Cytokeratin 17 Monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 17 Monoclonal Antibody
BT-MCA0421-02 100 µL

Cytokeratin 17 Monoclonal Antibody

Sign In for Pricing
View Details