Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CUL2 Rabbit Polyclonal Antibody (HRP)

CUL2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q13617

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CUL2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

81 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_003582

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRMPD1 siRNA (Mouse)
CRN5266-01 15 nmol

FRMPD1 siRNA (Mouse)

Sign In for Pricing
View Details
FRMPD1 siRNA (Mouse)
CRN5266-02 30 nmol

FRMPD1 siRNA (Mouse)

Sign In for Pricing
View Details
WISP2 (WNT1-inducible-signaling Pathway Protein 2, WISP-2, CCN Family Member 5, CCN5, Connective Tissue Growth Factor-like Protein, CTGF-L, CTGFL, Connective Tissue Growth Factor-related Protein 58, CT58, UNQ228/PRO261) (HRP)
MBS6155784-01 0.1 mL

WISP2 (WNT1-inducible-signaling Pathway Protein 2, WISP-2, CCN Family Member 5, CCN5, Connective Tissue Growth Factor-like Protein, CTGF-L, CTGFL, Connective Tissue Growth Factor-related Protein 58, CT58, UNQ228/PRO261) (HRP)

Sign In for Pricing
View Details
WISP2 (WNT1-inducible-signaling Pathway Protein 2, WISP-2, CCN Family Member 5, CCN5, Connective Tissue Growth Factor-like Protein, CTGF-L, CTGFL, Connective Tissue Growth Factor-related Protein 58, CT58, UNQ228/PRO261) (HRP)
MBS6155784-02 5x 0.1 mL

WISP2 (WNT1-inducible-signaling Pathway Protein 2, WISP-2, CCN Family Member 5, CCN5, Connective Tissue Growth Factor-like Protein, CTGF-L, CTGFL, Connective Tissue Growth Factor-related Protein 58, CT58, UNQ228/PRO261) (HRP)

Sign In for Pricing
View Details
MSK1 Polyclonal Antibody
E041183 100 µg -100 µL

MSK1 Polyclonal Antibody

Sign In for Pricing
View Details
MAPK8IP1/JIP1 Antibody
orb1535554 200 µL

MAPK8IP1/JIP1 Antibody

Sign In for Pricing
View Details