Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ICOS, Mouse (HEK293, His)

ICOS proteins optimize T cell responses to foreign antigens, promoting proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and efficient B cell antibody secretion. ICOS is essential for efficient communication of T cells and B cells and for normal antibody responses to T cell-dependent antigens. ICOS Protein, Mouse (HEK293, His) is the recombinant mouse-derived ICOS protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ICOS Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/icos-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKL

Molecular Formula

54167 (Gene_ID) Q9WVS0 (E21-L142) (Accession)

Molecular Weight

16-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synaptosome Associated Protein 25 Rabbit Monoclonal Antibody [KD Validation]
E51K62795 40 µL

Synaptosome Associated Protein 25 Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
IgD, Heavy Chain (APC)
MBS6268863-01 0.1 mL

IgD, Heavy Chain (APC)

Sign In for Pricing
View Details
IgD, Heavy Chain (APC)
MBS6268863-02 5x 0.1 mL

IgD, Heavy Chain (APC)

Sign In for Pricing
View Details
Rabbit Polyclonal SLC39A7/ZIP7 Antibody [Alexa Fluor 405]
NBP1-76504AF405 0.1 mL

Rabbit Polyclonal SLC39A7/ZIP7 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
SR9009
MBS3607262-01 2 mg

SR9009

Sign In for Pricing
View Details
SR9009
MBS3607262-02 5 mg

SR9009

Sign In for Pricing
View Details