Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBX1 Rabbit Polyclonal Antibody (Biotin)

RBX1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ROC1, RNF75, BA554C12.1

UniProt

P62877

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RBX1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055063

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC39A7 Protein Vector (Mouse) (pPB-C-His)
PV230874 500 ng

SLC39A7 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Rps6ka4 shRNA (UAS) - Lentiviral mouse Rps6ka4 shRNA (UAS) plasmid
GTR15183199 1 Vial

Lentiviral mouse Rps6ka4 shRNA (UAS) - Lentiviral mouse Rps6ka4 shRNA (UAS) plasmid

Sign In for Pricing
View Details
PPWD1 antibody
70R-4237 100 µL

PPWD1 antibody

Sign In for Pricing
View Details
RANBP2 Protein Vector (Rat) (pPM-C-His)
PV298105 500 ng

RANBP2 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Mycn 3'UTR Luciferase Stable Cell Line
TU113689 1.0 mL

Mycn 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit anti-ABLIM1 Antibody, Affinity Purified
MBS3902646-01 0.01 mg

Rabbit anti-ABLIM1 Antibody, Affinity Purified

Sign In for Pricing
View Details