Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBX1 Rabbit Polyclonal Antibody (HRP)

RBX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ROC1, RNF75, BA554C12.1

UniProt

P62877

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RBX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055063

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), Biotin conjugate, 0.1mg/mL
BNCB0096-500 1x 500 µL

Histone H1 (AE-4), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ROD1 (PTBP3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G7]
TA812031BM 100 µL

ROD1 (PTBP3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G7]

Sign In for Pricing
View Details
PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2718), CF647 conjugate, 0.1mg/mL
BNC472718-500 1x 500 µL

PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2718), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p-Nitrophenylthiol Acetate
TRC-N505900-1G 1 g

p-Nitrophenylthiol Acetate

Sign In for Pricing
View Details
Cytokeratin, pan (Epithelial Marker) (PCK/3150), CF568 conjugate, 0.1mg/mL
BNC683150-500 1x 500 µL

Cytokeratin, pan (Epithelial Marker) (PCK/3150), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Pancreas
CS505605 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details