Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CUL1 Rabbit Polyclonal Antibody (Biotin)

CUL1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q13616

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CUL1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003583

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tryptophan Hydroxylase (TPH1) (NM_004179) Human Tagged ORF Clone Lentiviral Particle
RC221254L1V 200 µL

Tryptophan Hydroxylase (TPH1) (NM_004179) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant human JNK2/MAPK9 protein
ATGP1649-020 20 µg

Recombinant human JNK2/MAPK9 protein

Sign In for Pricing
View Details
Lentiviral mouse Psmg2 shRNA (UAS) - Lentiviral mouse Psmg2 shRNA (UAS, iRFP) (25)
GTR15303317 1 Vial

Lentiviral mouse Psmg2 shRNA (UAS) - Lentiviral mouse Psmg2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Lentiviral human SLCO1C1 shRNA (UAS) - Lentiviral human SLCO1C1 shRNA (UAS, GFP) plasmid
GTR15345445 1 Vial

Lentiviral human SLCO1C1 shRNA (UAS) - Lentiviral human SLCO1C1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Kcnh4 sgRNA CRISPR Lentivector set (Mouse)
K3208501 3x 1.0 µg

Kcnh4 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
(S) -L-DABA dihydrochloride
TYD-01292-01 10 g

(S) -L-DABA dihydrochloride

Sign In for Pricing
View Details