Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYC Rabbit Polyclonal Antibody (Biotin)

MYC Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MRTL, MYCC, c-Myc, bHLHe39

UniProt

P01106

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MYC

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: APKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_002458

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPDC1 antibody
70R-1900 100 µL

NPDC1 antibody

Sign In for Pricing
View Details
FKBP14 CRISPR Activation Plasmid (m2)
sc-433130-ACT-2 20 µg

FKBP14 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
V1RI9 shRNA (m) Lentiviral Particles
sc-155084-V 200 µL

V1RI9 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
5' ATTO-520 / 3' DABCYL
orb1734453 20 to 29 nmol

5' ATTO-520 / 3' DABCYL

Sign In for Pricing
View Details
Anti-Pleckstrin Rabbit pAb
GB113675 100 μL

Anti-Pleckstrin Rabbit pAb

Sign In for Pricing
View Details
RT 5 heated multiplace magnetic stirrer; 5 stirring positions
STI2296 1 Each

RT 5 heated multiplace magnetic stirrer; 5 stirring positions

Sign In for Pricing
View Details