Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYC Rabbit Polyclonal Antibody (HRP)

MYC Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MRTL, MYCC, c-Myc, bHLHe39

UniProt

P01106

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MYC

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_002458

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRIK5 Rabbit Polyclonal Antibody
TA368460 100 µL

GRIK5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MMAB Rabbit Polyclonal Antibody
TA366453 100 µL

MMAB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD3e Mouse Monoclonal Antibody (SK7), CF®514 Conjugate - Biotium Choice
P002-514-500 1x 500 µL

CD3e Mouse Monoclonal Antibody (SK7), CF®514 Conjugate - Biotium Choice

Sign In for Pricing
View Details
LBR Polyclonal Antibody
E-AB-15166-01 20 µL

LBR Polyclonal Antibody

Sign In for Pricing
View Details
LBR Polyclonal Antibody
E-AB-15166-02 60 µL

LBR Polyclonal Antibody

Sign In for Pricing
View Details
LBR Polyclonal Antibody
E-AB-15166-03 120 µL

LBR Polyclonal Antibody

Sign In for Pricing
View Details