Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOS Rabbit Polyclonal Antibody (HRP)

FOS Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P55, AP-1, C-FOS

UniProt

P01100

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FOS

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCT

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_005243

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aurora B (Proliferation Marker) (rAURKB/1592), CF640R conjugate, 0.1mg/mL
BNC403787-500 1x 500 µL

Aurora B (Proliferation Marker) (rAURKB/1592), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CT45A5 activation kit by CRISPRa
GA118517 1 Kit

Human CT45A5 activation kit by CRISPRa

Sign In for Pricing
View Details
MEF2A (NM_005587) Human Recombinant Protein
TP312830 20 µg

MEF2A (NM_005587) Human Recombinant Protein

Sign In for Pricing
View Details
Slc26a3 Mouse Gene Knockout Kit (CRISPR)
KN516005 1 Kit

Slc26a3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat HPX (Hemopexin) CLIA Kit
E-CL-R0335-01 24 Tests

Rat HPX (Hemopexin) CLIA Kit

Sign In for Pricing
View Details
Rat HPX (Hemopexin) CLIA Kit
E-CL-R0335-02 48 Tests

Rat HPX (Hemopexin) CLIA Kit

Sign In for Pricing
View Details