Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL13 Rabbit Polyclonal Antibody (HRP)

CCL13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NCC1, CKb10, MCP-4, NCC-1, SCYL1, SCYA13

UniProt

Q99616

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CCL13

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_005399

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB23 Recombinant Protein (Mouse)
RP166226 100 µg

RAB23 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Annexin A8 Rabbit pAb, IRDye 800CW conjugated
orb2853687 100 µL

Annexin A8 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Gfi1 ORF Vector (Mouse) (pORF)
ORF045436 1.0 µg DNA

Gfi1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
GENLISA Human Peripherin 2 (PRPH2) ELISA
KBH14420 1x 96 Well

GENLISA Human Peripherin 2 (PRPH2) ELISA

Sign In for Pricing
View Details
Accuform Vial, Clear, Graduated
1219466 12 PK

Accuform Vial, Clear, Graduated

Sign In for Pricing
View Details
SOD (Cu/Zn superoxide dismutase, Amyotrophic lateral sclerosis 1 adult, Homodimer, ALS 1)
367837 100 µg

SOD (Cu/Zn superoxide dismutase, Amyotrophic lateral sclerosis 1 adult, Homodimer, ALS 1)

Sign In for Pricing
View Details