Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR4 Rabbit Polyclonal Antibody (FITC)

CCR4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CKR4, K5-5, CD194, CMKBR4, ChemR13, CC-CKR-4, HGCN:14099

UniProt

P51679

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CCR4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTL

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_005499

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SP1 Rabbit Polyclonal Antibody (PE)
orb2610767 100 µg

SP1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Lentiviral human KMT2A shRNA (UAS) - Lentiviral human KMT2A shRNA (UAS) plasmid
GTR15148351 1 Vial

Lentiviral human KMT2A shRNA (UAS) - Lentiviral human KMT2A shRNA (UAS) plasmid

Sign In for Pricing
View Details
Aldh1a7 3'UTR Luciferase Stable Cell Line
TU101662 1.0 mL

Aldh1a7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Bovine Serum Albumin-APC
TRP-00068-01 1 mL

Bovine Serum Albumin-APC

Sign In for Pricing
View Details
Bovine Serum Albumin-APC
TRP-00068-02 100 µL

Bovine Serum Albumin-APC

Sign In for Pricing
View Details
TROVE2 Recombinant Protein (Rat)
RP234833 100 µg

TROVE2 Recombinant Protein (Rat)

Sign In for Pricing
View Details