Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR4 Rabbit Polyclonal Antibody (FITC)

CCR4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CKR4, K5-5, CD194, CMKBR4, ChemR13, CC-CKR-4, HGCN:14099

UniProt

P51679

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CCR4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTL

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_005499

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CKMT1B shRNA (UAS) - Lentiviral human CKMT1B shRNA (UAS, GFP) plasmid
GTR15151330 1 Vial

Lentiviral human CKMT1B shRNA (UAS) - Lentiviral human CKMT1B shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Cux2 Rabbit Polyclonal Antibody (BF555)
orb2446471 100 µL

Cux2 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Human IFN-r (IFN-r) ELISA Kit
YP-W16901-01 48 Tests

Human IFN-r (IFN-r) ELISA Kit

Sign In for Pricing
View Details
Human IFN-r (IFN-r) ELISA Kit
YP-W16901-02 96 Tests

Human IFN-r (IFN-r) ELISA Kit

Sign In for Pricing
View Details
EGFR Antibody (Q861) Blocking peptide
orb1446229 500 µg

EGFR Antibody (Q861) Blocking peptide

Sign In for Pricing
View Details
CAPN3 Protein Vector (Human) (pPM-C-HA)
PV007439 500 ng

CAPN3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details