Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR4 Rabbit Polyclonal Antibody (HRP)

CCR4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CKR4, K5-5, CD194, CMKBR4, ChemR13, CC-CKR-4, HGCN:14099

UniProt

P51679

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CCR4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTL

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_005499

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione S Transferase kappa 1 Recombinant Rabbit mAb
orb2325560-01 25 µL

Glutathione S Transferase kappa 1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Glutathione S Transferase kappa 1 Recombinant Rabbit mAb
orb2325560-02 50 µL

Glutathione S Transferase kappa 1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Glutathione S Transferase kappa 1 Recombinant Rabbit mAb
orb2325560-03 100 µL

Glutathione S Transferase kappa 1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
TBCB Peptide
orb2013971 100 µg

TBCB Peptide

Sign In for Pricing
View Details
NPY discontinued
392337 200 µL

NPY discontinued

Sign In for Pricing
View Details
NFYA (Nuclear Transcription Factor Y Subunit alpha)
486859 100 µL

NFYA (Nuclear Transcription Factor Y Subunit alpha)

Sign In for Pricing
View Details