Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCL9 Rabbit Polyclonal Antibody (Biotin)

CXCL9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CMK, MIG, Humig, SCYB9, crg-10

UniProt

Q07325

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CXCL9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQ

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_002407

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPT1 Antibody, FITC conjugated
MBS7052299-01 0.05 mg

PPT1 Antibody, FITC conjugated

Sign In for Pricing
View Details
PPT1 Antibody, FITC conjugated
MBS7052299-02 0.1 mg

PPT1 Antibody, FITC conjugated

Sign In for Pricing
View Details
PPT1 Antibody, FITC conjugated
MBS7052299-03 5x 0.1 mg

PPT1 Antibody, FITC conjugated

Sign In for Pricing
View Details
DAGLA (Sn1-specific Diacylglycerol Lipase alpha, DGL-alpha, Neural Stem Cell-derived Dendrite Regulator, C11orf11, KIAA0659, NSDDR)
D3224-60A 100 µg

DAGLA (Sn1-specific Diacylglycerol Lipase alpha, DGL-alpha, Neural Stem Cell-derived Dendrite Regulator, C11orf11, KIAA0659, NSDDR)

Sign In for Pricing
View Details
Human PIGW Knockout A549 cell line
GTR15421698 1 Vial

Human PIGW Knockout A549 cell line

Sign In for Pricing
View Details
Prothrombin Fragment 1+2 (F1+2) BioAssayTM ELISA Kit (Human) discontinued
530066 96 Tests

Prothrombin Fragment 1+2 (F1+2) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details