Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCL9 Rabbit Polyclonal Antibody (HRP)

CXCL9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CMK, MIG, Humig, SCYB9, crg-10

UniProt

Q07325

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CXCL9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQ

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_002407

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker), CF740 conjugate, 0.1mg/mL
BNC741665-500 1x 500 µL

Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Atp5d Mouse Gene Knockout Kit (CRISPR)
KN501790 1 Kit

Atp5d Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse IgM Antibody
RD22088F-01 25 µg

PE/Cyanine5 Anti-Mouse IgM Antibody

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse IgM Antibody
RD22088F-02 100 µg

PE/Cyanine5 Anti-Mouse IgM Antibody

Sign In for Pricing
View Details
Dynamin 3 (DNM3) Rabbit Polyclonal Antibody
AP17991PU-N 400 µL

Dynamin 3 (DNM3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SIRPB1 (NM_001135844) Human Recombinant Protein
TP326750M 100 µg

SIRPB1 (NM_001135844) Human Recombinant Protein

Sign In for Pricing
View Details