Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR18 Rabbit Polyclonal Antibody (HRP)

GPR18 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q14330

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GPR18

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIYLKAVNVLNLTRLT

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_005283

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLR1C (NM_004875) Human Over-expression Lysate
LC429225 20 µg

POLR1C (NM_004875) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS805926 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF647 conjugate, 0.1mg/mL
BNC471461-500 1x 500 µL

CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human DIP2 homolog B (DIP2B) activation kit by CRISPRa
GA111630 1 Kit

Human DIP2 homolog B (DIP2B) activation kit by CRISPRa

Sign In for Pricing
View Details
hCG beta (CGB3) Mouse Monoclonal Antibody [Clone ID: SPM529]
AM50099PU-T 20 µg

hCG beta (CGB3) Mouse Monoclonal Antibody [Clone ID: SPM529]

Sign In for Pricing
View Details
MX1 (NM_002462) Human Over-expression Lysate
LC400886 20 µg

MX1 (NM_002462) Human Over-expression Lysate

Sign In for Pricing
View Details