Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DOK1 Rabbit Polyclonal Antibody (Biotin)

DOK1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Pp62, P62DOK

UniProt

Q99704

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DOK1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EPGTATGSGIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGST

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_001372

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Bromosalicylic Acid 99.5%
B24688-01 25 g

5-Bromosalicylic Acid 99.5%

Sign In for Pricing
View Details
5-Bromosalicylic Acid 99.5%
B24688-02 100 g

5-Bromosalicylic Acid 99.5%

Sign In for Pricing
View Details
5-Bromosalicylic Acid 99.5%
B24688-03 500 g

5-Bromosalicylic Acid 99.5%

Sign In for Pricing
View Details
Anti-RUFY3 Antibody Picoband® Fluoro550 Conjugated
A09453-1-Fluoro550 100 µg/Vial

Anti-RUFY3 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium UPF0299 membrane protein yohJ (yohJ)
orb2921476-01 20 µg

Recombinant Salmonella typhimurium UPF0299 membrane protein yohJ (yohJ)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium UPF0299 membrane protein yohJ (yohJ)
orb2921476-02 100 µg

Recombinant Salmonella typhimurium UPF0299 membrane protein yohJ (yohJ)

Sign In for Pricing
View Details