Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DOK1 Rabbit Polyclonal Antibody (FITC)

DOK1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Pp62, P62DOK

UniProt

Q99704

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DOK1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EPGTATGSGIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGST

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_001372

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Hu CD206 APC
MBS1800050-01 100 Tests

Anti-Hu CD206 APC

Sign In for Pricing
View Details
Anti-Hu CD206 APC
MBS1800050-02 5x 100 Tests

Anti-Hu CD206 APC

Sign In for Pricing
View Details
POLR3D (DNA-directed RNA Polymerase III Subunit RPC4, RNA Polymerase III Subunit C4, DNA-directed RNA Polymerase III Subunit D, Protein BN51, RNA Polymerase III 47kD Subunit, RPC53 Homolog, BN51, BN51T) (AP) discontinued
131598-AP 100 µL

POLR3D (DNA-directed RNA Polymerase III Subunit RPC4, RNA Polymerase III Subunit C4, DNA-directed RNA Polymerase III Subunit D, Protein BN51, RNA Polymerase III 47kD Subunit, RPC53 Homolog, BN51, BN51T) (AP) discontinued

Sign In for Pricing
View Details
H2-Q2 HDR Plasmid (m)
sc-420776-HDR 20 µg

H2-Q2 HDR Plasmid (m)

Sign In for Pricing
View Details
1-Bromo-4-nitrobenzene 99%
B22965 25 g

1-Bromo-4-nitrobenzene 99%

Sign In for Pricing
View Details
CILP Protein (N-GST, Human)
P502592 100 µg

CILP Protein (N-GST, Human)

Sign In for Pricing
View Details