Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DOK1 Rabbit Polyclonal Antibody (HRP)

DOK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pp62, P62DOK

UniProt

Q99704

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DOK1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EPGTATGSGIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGST

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_001372

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Narcissus pseudonarcissus (NPA) (Agarose)
N0019-45A 1 mL

Narcissus pseudonarcissus (NPA) (Agarose)

Sign In for Pricing
View Details
Rat Myo1a Pre-designed siRNA Set B
SI208937B 1 Each

Rat Myo1a Pre-designed siRNA Set B

Sign In for Pricing
View Details
Canine Exostoses 1 ELISA Kit
MBS053259-01 48 Well

Canine Exostoses 1 ELISA Kit

Sign In for Pricing
View Details
Canine Exostoses 1 ELISA Kit
MBS053259-02 96 Well

Canine Exostoses 1 ELISA Kit

Sign In for Pricing
View Details
Canine Exostoses 1 ELISA Kit
MBS053259-03 5x 96 Well

Canine Exostoses 1 ELISA Kit

Sign In for Pricing
View Details
Canine Exostoses 1 ELISA Kit
MBS053259-04 10x 96 Well

Canine Exostoses 1 ELISA Kit

Sign In for Pricing
View Details