Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAF1 Rabbit Polyclonal Antibody (FITC)

TRAF1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EBI6, MGC:10353

UniProt

Q13077

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRAF1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005649

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT15 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
25934064 1.0 µg DNA

KRT15 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
B Raf (BRAF) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B2]
TA500438AM 100 µL

B Raf (BRAF) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B2]

Sign In for Pricing
View Details
3-[5-Amino-4- (1,3-benzothiazol-2-yl) -3-oxo-2,3-dihydro-1H-pyrrol-1-yl]benzoic acid
EQA72661-01 250 mg

3-[5-Amino-4- (1,3-benzothiazol-2-yl) -3-oxo-2,3-dihydro-1H-pyrrol-1-yl]benzoic acid

Sign In for Pricing
View Details
3-[5-Amino-4- (1,3-benzothiazol-2-yl) -3-oxo-2,3-dihydro-1H-pyrrol-1-yl]benzoic acid
EQA72661-02 2.5 g

3-[5-Amino-4- (1,3-benzothiazol-2-yl) -3-oxo-2,3-dihydro-1H-pyrrol-1-yl]benzoic acid

Sign In for Pricing
View Details
Lentiviral mouse Mmp16 shRNA (UAS) - Lentiviral mouse Mmp16 shRNA (UAS, iRFP) plasmid
GTR15306703 1 Vial

Lentiviral mouse Mmp16 shRNA (UAS) - Lentiviral mouse Mmp16 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Rat FABP3 (Fatty Acid Binding Protein 3, Muscle And Heart) ELISA Kit
ELK5759-01 48 Tests

Rat FABP3 (Fatty Acid Binding Protein 3, Muscle And Heart) ELISA Kit

Sign In for Pricing
View Details