Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS10 Rabbit Polyclonal Antibody (Biotin)

RGS10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q96GN0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RGS10

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001005339

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1992), Biotin conjugate, 0.1mg/mL
BNCB1992-500 1x 500 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1992), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse H-2 Antibody[M1/42]
E-AB-F1216UH-01 25 µg

PE/Cyanine7 Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse H-2 Antibody[M1/42]
E-AB-F1216UH-02 100 µg

PE/Cyanine7 Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2745), CF568 conjugate, 0.1mg/mL
BNC682745-100 1x 100 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2745), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ephrin A5 Polyclonal Antibody
E-AB-16408-01 20 µL

Ephrin A5 Polyclonal Antibody

Sign In for Pricing
View Details
Ephrin A5 Polyclonal Antibody
E-AB-16408-02 60 µL

Ephrin A5 Polyclonal Antibody

Sign In for Pricing
View Details