Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS10 Rabbit Polyclonal Antibody (Biotin)

RGS10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q96GN0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RGS10

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001005339

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FHL1 (NM_001449) Human Over-expression Lysate
LC400563 20 µg

FHL1 (NM_001449) Human Over-expression Lysate

Sign In for Pricing
View Details
Rhoc Mouse Gene Knockout Kit (CRISPR)
KN514768 1 Kit

Rhoc Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Histone H2A (Acetyl Lys5) Monoclonal Antibody
AN301414L-01 50 µL

Recombinant Histone H2A (Acetyl Lys5) Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Histone H2A (Acetyl Lys5) Monoclonal Antibody
AN301414L-02 100 µL

Recombinant Histone H2A (Acetyl Lys5) Monoclonal Antibody

Sign In for Pricing
View Details
Human TLR4 activation kit by CRISPRa
GA104900 1 Kit

Human TLR4 activation kit by CRISPRa

Sign In for Pricing
View Details
DDX3 (DDX3X) Human Gene Knockout Kit (CRISPR)
KN204171RB 1 Kit

DDX3 (DDX3X) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details