Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS5 Rabbit Polyclonal Antibody (Biotin)

RGS5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MST092, MST106, MST129, MSTP032, MSTP092, MSTP106, MSTP129

UniProt

O15539

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RGS5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKS

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_003608

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS639042 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS803118 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
GLUD1 Rabbit Polyclonal Antibody
TA376611 100 µL

GLUD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HSV1 (Herpes Simplex Virus Type I) (HSV1/1934), CF488A conjugate, 0.1mg/mL
BNC881934-100 1x 100 µL

HSV1 (Herpes Simplex Virus Type I) (HSV1/1934), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OVCA1 (DPH1) Human Gene Knockout Kit (CRISPR)
KN221955 1 Kit

OVCA1 (DPH1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GADD45A (NM_001924) Human Recombinant Protein
TP720561L 500 µg

GADD45A (NM_001924) Human Recombinant Protein

Sign In for Pricing
View Details