Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS5 Rabbit Polyclonal Antibody (Biotin)

RGS5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MST092, MST106, MST129, MSTP032, MSTP092, MSTP106, MSTP129

UniProt

O15539

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RGS5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKS

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_003608

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAD3 (MXD3) Mouse Monoclonal Antibody [Clone ID: N129/15]
75-250 100 µL

MAD3 (MXD3) Mouse Monoclonal Antibody [Clone ID: N129/15]

Sign In for Pricing
View Details
Human DEF6 activation kit by CRISPRa
GA109433 1 Kit

Human DEF6 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Protein Lysate, Liver
CP520662 150 µg

Tissue Protein Lysate, Liver

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS646414 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
HypoGel® 200 RAM
SP200110150230.5G 5 g

HypoGel® 200 RAM

Sign In for Pricing
View Details
Rotary Evaporator BREV-103
BREV-103 1 Unit

Rotary Evaporator BREV-103

Sign In for Pricing
View Details