Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS5 Rabbit Polyclonal Antibody (HRP)

RGS5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MST092, MST106, MST129, MSTP032, MSTP092, MSTP106, MSTP129

UniProt

O15539

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RGS5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKS

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_003608

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHGA2 CytoSection
TS410863P5 25 Slides

PCDHGA2 CytoSection

Sign In for Pricing
View Details
CD99 (MIC2/877), 0.2mg/mL
BNUB0877-500 1x 500 µL

CD99 (MIC2/877), 0.2mg/mL

Sign In for Pricing
View Details
Rph3al Mouse Gene Knockout Kit (CRISPR)
KN515009 1 Kit

Rph3al Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Single Arm LED Operating Lamp BOPL-406
BOPL-406 1 Unit

Single Arm LED Operating Lamp BOPL-406

Sign In for Pricing
View Details
Soybean Oil Epoxide
TRC-S677863-10G 10 g

Soybean Oil Epoxide

Sign In for Pricing
View Details
TUG Recombinant Rabbit Monoclonal Antibody [JE59-09]
HA720029 100 µL

TUG Recombinant Rabbit Monoclonal Antibody [JE59-09]

Sign In for Pricing
View Details