Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DOK2 Rabbit Polyclonal Antibody (Biotin)

DOK2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P56DOK, p56dok-2

UniProt

O60496

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DOK2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QEPRGEAWRRQATRDRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKG

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_003965

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF1A1 Rabbit pAb, PerCP-Cy7 conjugated
orb2841728 100 µL

EEF1A1 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Recombinant Human FOXO3 protein
MBS1561032-01 0.05 mg

Recombinant Human FOXO3 protein

Sign In for Pricing
View Details
Recombinant Human FOXO3 protein
MBS1561032-02 0.1 mg

Recombinant Human FOXO3 protein

Sign In for Pricing
View Details
Recombinant Human FOXO3 protein
MBS1561032-03 5x 0.1 mg

Recombinant Human FOXO3 protein

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Myxovirus Resistance 1 (MX1)
MBS2144815-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Myxovirus Resistance 1 (MX1)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Myxovirus Resistance 1 (MX1)
MBS2144815-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Myxovirus Resistance 1 (MX1)

Sign In for Pricing
View Details