Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DOK2 Rabbit Polyclonal Antibody (HRP)

DOK2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P56DOK, p56dok-2

UniProt

O60496

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DOK2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QEPRGEAWRRQATRDRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKG

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_003965

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Map3k6 Antibody (N-term) Blocking peptide
MBS9220297-01 0.5 mg

Mouse Map3k6 Antibody (N-term) Blocking peptide

Sign In for Pricing
View Details
Mouse Map3k6 Antibody (N-term) Blocking peptide
MBS9220297-02 5x 0.5 mg

Mouse Map3k6 Antibody (N-term) Blocking peptide

Sign In for Pricing
View Details
Anti-SLC6A11 Polyclonal Antibody
PTX26780-01 50 µg

Anti-SLC6A11 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SLC6A11 Polyclonal Antibody
PTX26780-02 100 µg

Anti-SLC6A11 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SLC6A11 Polyclonal Antibody
PTX26780-03 1 mg

Anti-SLC6A11 Polyclonal Antibody

Sign In for Pricing
View Details
Human GPR75 Protein, hFc Tag
orb1173674-01 10 µg

Human GPR75 Protein, hFc Tag

Sign In for Pricing
View Details