Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNASEL Rabbit Polyclonal Antibody (HRP)

RNASEL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RNS4, PRCA1

UniProt

Q05823

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RNASEL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGA

Field of Research

Infectious Disease & Virology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_066956

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BM045 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
TL320072V 500 µL Each

BM045 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Sign In for Pricing
View Details
Rat Dlat (Dihydrolipoyl Transacetylase) ELISA Kit
FY-ER2629 96 Well

Rat Dlat (Dihydrolipoyl Transacetylase) ELISA Kit

Sign In for Pricing
View Details
FGFR1 (NM_023108) Human 3' UTR Clone
SC211346 10 µg

FGFR1 (NM_023108) Human 3' UTR Clone

Sign In for Pricing
View Details
Recombinant Human GNGT1/GNG1 Protein (His Tag)
PKSH030582 100 µg

Recombinant Human GNGT1/GNG1 Protein (His Tag)

Sign In for Pricing
View Details
ZNF19 Antibody, FITC conjugated
MBS1496067-01 0.05 mg

ZNF19 Antibody, FITC conjugated

Sign In for Pricing
View Details
ZNF19 Antibody, FITC conjugated
MBS1496067-02 0.1 mg

ZNF19 Antibody, FITC conjugated

Sign In for Pricing
View Details