Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDCD4 Rabbit Polyclonal Antibody (HRP)

PDCD4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

H731

UniProt

Q53EL6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PDCD4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTKYPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAKR

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_663314

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetyl Coenzyme A Carboxylase Alpha (ACACa) Magnetic Fluorescence Assay Kit
MBS2157176-01 96 Tests

Acetyl Coenzyme A Carboxylase Alpha (ACACa) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Acetyl Coenzyme A Carboxylase Alpha (ACACa) Magnetic Fluorescence Assay Kit
MBS2157176-02 5x 96 Tests

Acetyl Coenzyme A Carboxylase Alpha (ACACa) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Acetyl Coenzyme A Carboxylase Alpha (ACACa) Magnetic Fluorescence Assay Kit
MBS2157176-03 10x 96 Tests

Acetyl Coenzyme A Carboxylase Alpha (ACACa) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Rabbit Anti-Human IgG+IgM+IgA - TRITC
CSA2624-01 100 µL

Rabbit Anti-Human IgG+IgM+IgA - TRITC

Sign In for Pricing
View Details
Rabbit Anti-Human IgG+IgM+IgA - TRITC
CSA2624-02 500 μL

Rabbit Anti-Human IgG+IgM+IgA - TRITC

Sign In for Pricing
View Details
Rabbit Anti-Human IgG+IgM+IgA - TRITC
CSA2624-03 1 mL

Rabbit Anti-Human IgG+IgM+IgA - TRITC

Sign In for Pricing
View Details