Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDCD4 Rabbit Polyclonal Antibody (Biotin)

PDCD4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

H731

UniProt

O15501

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PDCD4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MTKYPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAKR

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055271

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tent5c Pre-designed siRNA Set A
SI114446A 1 Each

Mouse Tent5c Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse Ionized Calcium-binding Adapter Molecule 1 (IBA1) CLIA Kit
MBS2709083-01 24 Strip Well

Mouse Ionized Calcium-binding Adapter Molecule 1 (IBA1) CLIA Kit

Sign In for Pricing
View Details
Mouse Ionized Calcium-binding Adapter Molecule 1 (IBA1) CLIA Kit
MBS2709083-02 48 Well

Mouse Ionized Calcium-binding Adapter Molecule 1 (IBA1) CLIA Kit

Sign In for Pricing
View Details
Mouse Ionized Calcium-binding Adapter Molecule 1 (IBA1) CLIA Kit
MBS2709083-03 96 Well

Mouse Ionized Calcium-binding Adapter Molecule 1 (IBA1) CLIA Kit

Sign In for Pricing
View Details
Mouse Ionized Calcium-binding Adapter Molecule 1 (IBA1) CLIA Kit
MBS2709083-04 5x 96 Well

Mouse Ionized Calcium-binding Adapter Molecule 1 (IBA1) CLIA Kit

Sign In for Pricing
View Details
Mouse Ionized Calcium-binding Adapter Molecule 1 (IBA1) CLIA Kit
MBS2709083-05 10x 96 Well

Mouse Ionized Calcium-binding Adapter Molecule 1 (IBA1) CLIA Kit

Sign In for Pricing
View Details