Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFKB1 Rabbit Polyclonal Antibody (Biotin)

NFKB1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KBF1, EBP-1, NF-kB, CVID12, NF-kB1, NFKB-p50, NFkappaB, NF-kappaB, NFKB-p105, NF-kappa-B1, NF-kappabeta

UniProt

P19838

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NFKB1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQEGPLEGK

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

105kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003989

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRA9D Protein Vector (Human) (pPM-C-HA)
20924021 500 ng

FRA9D Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Monoclonal Caspase-6 Antibody (M378)
NBP3-23183 0.1 mL

Mouse Monoclonal Caspase-6 Antibody (M378)

Sign In for Pricing
View Details
M7-10-473 Pre-sized Labels for Printers
173432 750 Box (750 Label (s) x 1 Roll)

M7-10-473 Pre-sized Labels for Printers

Sign In for Pricing
View Details
Mouse Anti-Human REG4 monoclonal antibody, clone NN12
CABT-ZB1022 50 μl

Mouse Anti-Human REG4 monoclonal antibody, clone NN12

Sign In for Pricing
View Details
TBST 10X, 2% Tween-20
40121263-2 1 L

TBST 10X, 2% Tween-20

Sign In for Pricing
View Details
TEF1 (TEAD1) Human shRNA Plasmid Kit (Locus ID 7003)
TL301160 1 Kit

TEF1 (TEAD1) Human shRNA Plasmid Kit (Locus ID 7003)

Sign In for Pricing
View Details