Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFKB1 Rabbit Polyclonal Antibody (Biotin)

NFKB1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KBF1, EBP-1, NF-kB, CVID12, NF-kB1, NFKB-p50, NFkappaB, NF-kappaB, NFKB-p105, NF-kappa-B1, NF-kappabeta

UniProt

P19838

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NFKB1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQEGPLEGK

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

105kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003989

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LeaBiozyme® Benzonase
E45O56028E0 100 KU

LeaBiozyme® Benzonase

Sign In for Pricing
View Details
C12orf66 (NM_001300940) Human Tagged ORF Clone
RC238404 10 µg

C12orf66 (NM_001300940) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae serotype 1 Chorismate--pyruvate lyase (ubiC)
MBS1374644-01 0.02 mg (E-Coli)

Recombinant Shigella dysenteriae serotype 1 Chorismate--pyruvate lyase (ubiC)

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae serotype 1 Chorismate--pyruvate lyase (ubiC)
MBS1374644-02 0.1 mg (E-Coli)

Recombinant Shigella dysenteriae serotype 1 Chorismate--pyruvate lyase (ubiC)

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae serotype 1 Chorismate--pyruvate lyase (ubiC)
MBS1374644-03 0.02 mg (Yeast)

Recombinant Shigella dysenteriae serotype 1 Chorismate--pyruvate lyase (ubiC)

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae serotype 1 Chorismate--pyruvate lyase (ubiC)
MBS1374644-04 0.1 mg (Yeast)

Recombinant Shigella dysenteriae serotype 1 Chorismate--pyruvate lyase (ubiC)

Sign In for Pricing
View Details