Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFKB1 Rabbit Polyclonal Antibody (FITC)

NFKB1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KBF1, EBP-1, NF-kB, CVID12, NF-kB1, NFKB-p50, NFkappaB, NF-kappaB, NFKB-p105, NF-kappa-B1, NF-kappabeta

UniProt

P19838

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NFKB1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQEGPLEGK

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

105kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003989

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARP1 Antibody
MBS9232763-01 0.1 mL

PARP1 Antibody

Sign In for Pricing
View Details
PARP1 Antibody
MBS9232763-02 5x 0.1 mL

PARP1 Antibody

Sign In for Pricing
View Details
Tau-4 Mouse Monoclonal Antibody (APC)
orb2364321 100 µL

Tau-4 Mouse Monoclonal Antibody (APC)

Sign In for Pricing
View Details
Mouse Integrin Associated Protein (IAP) ELISA Kit
DLR-IAP-Mu-01 48 Tests

Mouse Integrin Associated Protein (IAP) ELISA Kit

Sign In for Pricing
View Details
Mouse Integrin Associated Protein (IAP) ELISA Kit
DLR-IAP-Mu-02 96 Tests

Mouse Integrin Associated Protein (IAP) ELISA Kit

Sign In for Pricing
View Details
CD163 Recombinant Rabbit mAb, FITC conjugated
orb1607204 100 µL

CD163 Recombinant Rabbit mAb, FITC conjugated

Sign In for Pricing
View Details