Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFDP1 Rabbit Polyclonal Antibody (Biotin)

TFDP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DP1, DILC, Dp-1, DRTF1

UniProt

Q14186

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TFDP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDED

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009042

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD68 Polyclonal Antibody, PE-Cy5 Conjugated
bs-1432R-PE-Cy5-01 20 µL

CD68 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
CD68 Polyclonal Antibody, PE-Cy5 Conjugated
bs-1432R-PE-Cy5-02 100 µL

CD68 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Anti-EPOR Antibody, Rabbit Polyclonal
MBS8103666-01 0.1 mL

Anti-EPOR Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-EPOR Antibody, Rabbit Polyclonal
MBS8103666-02 5x 0.1 mL

Anti-EPOR Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
IGHV4-55 sgRNA CRISPR Lentivector (Human) (Target 3)
K1043504 1.0 µg DNA

IGHV4-55 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans twk-18 Polyclonal Antibody
MBS7190603 Inquire

Rabbit anti-Caenorhabditis elegans twk-18 Polyclonal Antibody

Sign In for Pricing
View Details