Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFDP1 Rabbit Polyclonal Antibody (HRP)

TFDP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DP1, DILC, Dp-1, DRTF1

UniProt

Q14186

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TFDP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDED

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009042

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WT1 (Wilm's Tumor 1) (WT1/857 + 6F-H2), CF405M conjugate, 0.1mg/mL
BNC051138-100 1x 100 µL

WT1 (Wilm's Tumor 1) (WT1/857 + 6F-H2), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse RBP4 Protein (His Tag)
PKSM040828 100 µg

Recombinant Mouse RBP4 Protein (His Tag)

Sign In for Pricing
View Details
Amplite® Luminometric Peroxidase (HRP) Assay Kit
11559-AAT 500 Tests

Amplite® Luminometric Peroxidase (HRP) Assay Kit

Sign In for Pricing
View Details
Horizontal Autoclave BAHZ-402-B
BAHZ-402-B 1 Unit

Horizontal Autoclave BAHZ-402-B

Sign In for Pricing
View Details
EGF Receptor Antibody
F40415-0.08ML 0.08 mL

EGF Receptor Antibody

Sign In for Pricing
View Details
IL17D Human
OM296470-01 25 µg

IL17D Human

Sign In for Pricing
View Details