Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHM Rabbit Polyclonal Antibody (FITC)

CHM Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TCD, GGTA, REP-1, DXS540, HSD-32

UniProt

P24386

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CHM

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LHVDSRSYYGGNWASFSFSGLLSWLKEYQENSDIVSDSPVWQDQILENEE

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_000381

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Kruppel Like Factor 4, Gut ELISA Kit
MBS067039-01 48 Well

Rat Kruppel Like Factor 4, Gut ELISA Kit

Sign In for Pricing
View Details
Rat Kruppel Like Factor 4, Gut ELISA Kit
MBS067039-02 96 Well

Rat Kruppel Like Factor 4, Gut ELISA Kit

Sign In for Pricing
View Details
Rat Kruppel Like Factor 4, Gut ELISA Kit
MBS067039-03 5x 96 Well

Rat Kruppel Like Factor 4, Gut ELISA Kit

Sign In for Pricing
View Details
Rat Kruppel Like Factor 4, Gut ELISA Kit
MBS067039-04 10x 96 Well

Rat Kruppel Like Factor 4, Gut ELISA Kit

Sign In for Pricing
View Details
Deoxyribonuclease I (DNase I) (MaxLight 405) discontinued
D3200-05C-ML405 100 µL

Deoxyribonuclease I (DNase I) (MaxLight 405) discontinued

Sign In for Pricing
View Details
GLR1.3 Antibody
PHY1159A 150 μg

GLR1.3 Antibody

Sign In for Pricing
View Details