Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HTR4 Rabbit Polyclonal Antibody (HRP)

HTR4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

5-HT4, 5-HT4R

UniProt

Q13639

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HTR4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYA

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000861

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNORD115-21 ORF Vector (Human) (pORF)
ORF032856 1.0 µg DNA

SNORD115-21 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
IRF2 Protein Vector (Human) (pPM-C-HA)
25078021 500 ng

IRF2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Clostridium Cellulolyticum ddl Protein (aa 1-376)
VAng-Lsx8913-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Cellulolyticum ddl Protein (aa 1-376)

Sign In for Pricing
View Details
Recombinant Cysteine And Glycine Rich Protein 1 (CSRP1)
MBS2162800-01 0.01 mg

Recombinant Cysteine And Glycine Rich Protein 1 (CSRP1)

Sign In for Pricing
View Details
Recombinant Cysteine And Glycine Rich Protein 1 (CSRP1)
MBS2162800-02 0.05 mg

Recombinant Cysteine And Glycine Rich Protein 1 (CSRP1)

Sign In for Pricing
View Details
Recombinant Cysteine And Glycine Rich Protein 1 (CSRP1)
MBS2162800-03 0.1 mg

Recombinant Cysteine And Glycine Rich Protein 1 (CSRP1)

Sign In for Pricing
View Details