Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNB3 Rabbit Polyclonal Antibody (HRP)

CHRNB3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q05901

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CHRNB3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITY

Field of Research

Neuroscience

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000740

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CREB1-S133 Rabbit pAb
AP0019 100 µL

Phospho-CREB1-S133 Rabbit pAb

Sign In for Pricing
View Details
PLV3-U6-AKR1C2-shRNA1-CopGFP-Puro Plasmid
PVT67442 2 µg

PLV3-U6-AKR1C2-shRNA1-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
V-Set And Immunoglobulin Domain-Containing Protein 4 (VSIG4) Antibody (FITC)
abx316698-01 20 µg

V-Set And Immunoglobulin Domain-Containing Protein 4 (VSIG4) Antibody (FITC)

Sign In for Pricing
View Details
V-Set And Immunoglobulin Domain-Containing Protein 4 (VSIG4) Antibody (FITC)
abx316698-02 50 µg

V-Set And Immunoglobulin Domain-Containing Protein 4 (VSIG4) Antibody (FITC)

Sign In for Pricing
View Details
V-Set And Immunoglobulin Domain-Containing Protein 4 (VSIG4) Antibody (FITC)
abx316698-03 100 µg

V-Set And Immunoglobulin Domain-Containing Protein 4 (VSIG4) Antibody (FITC)

Sign In for Pricing
View Details
V-Set And Immunoglobulin Domain-Containing Protein 4 (VSIG4) Antibody (FITC)
abx316698-04 200 µg

V-Set And Immunoglobulin Domain-Containing Protein 4 (VSIG4) Antibody (FITC)

Sign In for Pricing
View Details