Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABRP Rabbit Polyclonal Antibody (HRP)

GABRP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC126386, MGC126387

UniProt

O00591

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GABRP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_055026

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGCLL1 Antibody Blocking Peptide
orb1509610 500 µg

HMGCLL1 Antibody Blocking Peptide

Sign In for Pricing
View Details
RGD1566226 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6514105 3x 1.0 µg

RGD1566226 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
(1R,3S) -3-[ (2R) -2-Phenylpropanamido]cyclopentane-1-carboxylic acid
NCD28959-01 50 mg

(1R,3S) -3-[ (2R) -2-Phenylpropanamido]cyclopentane-1-carboxylic acid

Sign In for Pricing
View Details
(1R,3S) -3-[ (2R) -2-Phenylpropanamido]cyclopentane-1-carboxylic acid
NCD28959-02 0.5 g

(1R,3S) -3-[ (2R) -2-Phenylpropanamido]cyclopentane-1-carboxylic acid

Sign In for Pricing
View Details
E4F1 (Transcription Factor E4F1, E4F Transcription Factor 1, Putative E3 Ubiquitin-protein Ligase E4F1, Transcription Factor E4F, p120E4F, p50E4F, E4F, MGC99614) (PE)
MBS6376897-01 0.1 mL

E4F1 (Transcription Factor E4F1, E4F Transcription Factor 1, Putative E3 Ubiquitin-protein Ligase E4F1, Transcription Factor E4F, p120E4F, p50E4F, E4F, MGC99614) (PE)

Sign In for Pricing
View Details
E4F1 (Transcription Factor E4F1, E4F Transcription Factor 1, Putative E3 Ubiquitin-protein Ligase E4F1, Transcription Factor E4F, p120E4F, p50E4F, E4F, MGC99614) (PE)
MBS6376897-02 5x 0.1 mL

E4F1 (Transcription Factor E4F1, E4F Transcription Factor 1, Putative E3 Ubiquitin-protein Ligase E4F1, Transcription Factor E4F, p120E4F, p50E4F, E4F, MGC99614) (PE)

Sign In for Pricing
View Details