Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABRP Rabbit Polyclonal Antibody (FITC)

GABRP Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

O00591

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GABRP

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055026

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CARD10 polyclonal antibody
BS67225 50ul

CARD10 polyclonal antibody

Sign In for Pricing
View Details
Magohb (NM_025564) Mouse Tagged ORF Clone
MR200983 10 µg

Magohb (NM_025564) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
USP4, NT (USP4, UNP, UNPH, Ubiquitin carboxyl-terminal hydrolase 4, Deubiquitinating enzyme 4, Ubiquitin thioesterase 4, Ubiquitin-specific-processing protease 4, Ubiquitous nuclear protein homolog) (Biotin) discontinued
043671-Biotin 200 µL

USP4, NT (USP4, UNP, UNPH, Ubiquitin carboxyl-terminal hydrolase 4, Deubiquitinating enzyme 4, Ubiquitin thioesterase 4, Ubiquitin-specific-processing protease 4, Ubiquitous nuclear protein homolog) (Biotin) discontinued

Sign In for Pricing
View Details
Cldn14 Mouse shRNA Plasmid (Locus ID 56173)
TR503097 1 Kit

Cldn14 Mouse shRNA Plasmid (Locus ID 56173)

Sign In for Pricing
View Details
Recombinant Pyrococcus horikoshii Replication factor C large subunit (rfcL)
MBS1071360-01 0.02 mg (E-Coli)

Recombinant Pyrococcus horikoshii Replication factor C large subunit (rfcL)

Sign In for Pricing
View Details
Recombinant Pyrococcus horikoshii Replication factor C large subunit (rfcL)
MBS1071360-02 0.02 mg (Yeast)

Recombinant Pyrococcus horikoshii Replication factor C large subunit (rfcL)

Sign In for Pricing
View Details