Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRIK4 Rabbit Polyclonal Antibody (HRP)

GRIK4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KA1, EAA1, GRIK, GluK4

UniProt

Q16099

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GRIK4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RAPERLGKAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPAS

Field of Research

Neuroscience

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

107kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055434

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLD Protein Vector (Mouse) (pPB-C-His)
PV172210 500 ng

DLD Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
BCL2L15 Rabbit monoclonal antibody
orb2296941-01 25 µL

BCL2L15 Rabbit monoclonal antibody

Sign In for Pricing
View Details
BCL2L15 Rabbit monoclonal antibody
orb2296941-02 50 µL

BCL2L15 Rabbit monoclonal antibody

Sign In for Pricing
View Details
BCL2L15 Rabbit monoclonal antibody
orb2296941-03 100 µL

BCL2L15 Rabbit monoclonal antibody

Sign In for Pricing
View Details
Lentiviral mouse H1f5 shRNA (UAS) - Lentiviral mouse H1f5 shRNA (UAS, RFP) plasmid
GTR15168013 1 Vial

Lentiviral mouse H1f5 shRNA (UAS) - Lentiviral mouse H1f5 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Sheep Bile Salt-Activated Lipase (BSAL) ELISA Kit
MBS9375647-01 48 Well

Sheep Bile Salt-Activated Lipase (BSAL) ELISA Kit

Sign In for Pricing
View Details