Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HTR1A Rabbit Polyclonal Antibody (Biotin)

HTR1A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

G-21, 5HT1a, PFMCD, 5-HT1A, 5-HT-1A, ADRBRL1, ADRB2RL1

UniProt

P08908

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HTR1A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNAC

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_000515

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Tripartite motif-containing protein 21, TRIM21/RNF81 ELISA Kit
MBS9304863-01 48 Well

Bovine Tripartite motif-containing protein 21, TRIM21/RNF81 ELISA Kit

Sign In for Pricing
View Details
Bovine Tripartite motif-containing protein 21, TRIM21/RNF81 ELISA Kit
MBS9304863-02 96 Well

Bovine Tripartite motif-containing protein 21, TRIM21/RNF81 ELISA Kit

Sign In for Pricing
View Details
Bovine Tripartite motif-containing protein 21, TRIM21/RNF81 ELISA Kit
MBS9304863-03 5x 96 Well

Bovine Tripartite motif-containing protein 21, TRIM21/RNF81 ELISA Kit

Sign In for Pricing
View Details
Bovine Tripartite motif-containing protein 21, TRIM21/RNF81 ELISA Kit
MBS9304863-04 10x 96 Well

Bovine Tripartite motif-containing protein 21, TRIM21/RNF81 ELISA Kit

Sign In for Pricing
View Details
Mouse Bladder Smooth Muscle Cells
CP-M059 5x 10^5 Cells/Vial

Mouse Bladder Smooth Muscle Cells

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Folate Receptor 1, Adult (FOLR1)
MBS2095985-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Folate Receptor 1, Adult (FOLR1)

Sign In for Pricing
View Details