Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HTR2C Rabbit Polyclonal Antibody (HRP)

HTR2C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HTR1C, 5-HT1C, 5-HT2C, 5HTR2C, 5-HTR2C

UniProt

P28335

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HTR2C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMA

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000859

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WNT10A Protein Vector (Mouse) (pPB-C-His)
PV247542 500 ng

WNT10A Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Anti-FGF23 Antibody (Clone# FGF23/4162)
A2230-100 100 µg

Anti-FGF23 Antibody (Clone# FGF23/4162)

Sign In for Pricing
View Details
Monoclonal Antibody to Cross Linked N-Telopeptide Of Type I Collagen (NTXI)
TRV-0034300-01 20 µL

Monoclonal Antibody to Cross Linked N-Telopeptide Of Type I Collagen (NTXI)

Sign In for Pricing
View Details
Monoclonal Antibody to Cross Linked N-Telopeptide Of Type I Collagen (NTXI)
TRV-0034300-02 100 µL

Monoclonal Antibody to Cross Linked N-Telopeptide Of Type I Collagen (NTXI)

Sign In for Pricing
View Details
Monoclonal Antibody to Cross Linked N-Telopeptide Of Type I Collagen (NTXI)
TRV-0034300-03 200 µL

Monoclonal Antibody to Cross Linked N-Telopeptide Of Type I Collagen (NTXI)

Sign In for Pricing
View Details
Monoclonal Antibody to Cross Linked N-Telopeptide Of Type I Collagen (NTXI)
TRV-0034300-04 1 mL

Monoclonal Antibody to Cross Linked N-Telopeptide Of Type I Collagen (NTXI)

Sign In for Pricing
View Details