Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAPA Rabbit Polyclonal Antibody (Biotin)

NAPA Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SNAPA

UniProt

P54920

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NAPA

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAAN

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Mouse, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003818

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human REEP6 shRNA (UAS) - Lentiviral human REEP6 shRNA (UAS) (25)
GTR15326696 1 Vial

Lentiviral human REEP6 shRNA (UAS) - Lentiviral human REEP6 shRNA (UAS) (25)

Sign In for Pricing
View Details
LOC285033 (NM_001037228) Human Recombinant Protein
PH37013M5 20 µg

LOC285033 (NM_001037228) Human Recombinant Protein

Sign In for Pricing
View Details
Bovine Growth Differentiation Factor 6 ELISA kit
GTR10462269 96 Well

Bovine Growth Differentiation Factor 6 ELISA kit

Sign In for Pricing
View Details
AdmiRa-hsa-miR-501-5p-Off Virus
mh5884 1.0 mL

AdmiRa-hsa-miR-501-5p-Off Virus

Sign In for Pricing
View Details
CD40 (CD40 Ligand, TNF Ligand Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (MaxLight 750)
MBS6410335-01 0.1 mL

CD40 (CD40 Ligand, TNF Ligand Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (MaxLight 750)

Sign In for Pricing
View Details
CD40 (CD40 Ligand, TNF Ligand Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (MaxLight 750)
MBS6410335-02 5x 0.1 mL

CD40 (CD40 Ligand, TNF Ligand Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (MaxLight 750)

Sign In for Pricing
View Details