Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB3A Rabbit Polyclonal Antibody (FITC)

RAB3A Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P20336

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RAB3A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_002857

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Niemann-Pick C1-Like Protein 1 ELISA Kit
MBS7263009-01 48 Well

Monkey Niemann-Pick C1-Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
Monkey Niemann-Pick C1-Like Protein 1 ELISA Kit
MBS7263009-02 96 Well

Monkey Niemann-Pick C1-Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
Monkey Niemann-Pick C1-Like Protein 1 ELISA Kit
MBS7263009-03 5x 96 Well

Monkey Niemann-Pick C1-Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
Monkey Niemann-Pick C1-Like Protein 1 ELISA Kit
MBS7263009-04 10x 96 Well

Monkey Niemann-Pick C1-Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi C Spermidine synthase (speE)
MBS1263221-01 0.02 mg (E-Coli)

Recombinant Salmonella paratyphi C Spermidine synthase (speE)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi C Spermidine synthase (speE)
MBS1263221-02 0.02 mg (Yeast)

Recombinant Salmonella paratyphi C Spermidine synthase (speE)

Sign In for Pricing
View Details