Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB3D Rabbit Polyclonal Antibody (HRP)

RAB3D Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GOV, D2-2, RAB16, RAD3D

UniProt

O95716

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RAB3D

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSS

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004274

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBC1D8 Protein Vector (Human) (pPB-C-His)
PV134910 500 ng

TBC1D8 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Anti-ClC-5/CLCN5 Antibody Picoband® (Dylight488 Conjugate)
A02286-2-Dylight488 100 µg

Anti-ClC-5/CLCN5 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Olr1695 Protein Vector (Rat) (pPB-N-His)
PV289003 500 ng

Olr1695 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Interleukin 15 (IL-15) (MaxLight 750)
MBS6483081-01 0.1 mL

Interleukin 15 (IL-15) (MaxLight 750)

Sign In for Pricing
View Details
Interleukin 15 (IL-15) (MaxLight 750)
MBS6483081-02 5x 0.1 mL

Interleukin 15 (IL-15) (MaxLight 750)

Sign In for Pricing
View Details
Rat Dvl2 Pre-designed siRNA Set A
SI204127A 1 Each

Rat Dvl2 Pre-designed siRNA Set A

Sign In for Pricing
View Details