Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB3D Rabbit Polyclonal Antibody (HRP)

RAB3D Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GOV, D2-2, RAB16, RAD3D

UniProt

O95716

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RAB3D

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSS

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004274

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parasteatoda tepidariorim Wnt8 Rabbit Polyclonal Antibody (APC)
orb2571388 200 µL

Parasteatoda tepidariorim Wnt8 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Recombinant Mouse Crisp4 Protein, N-His
ARO-P10953-01 50 µg

Recombinant Mouse Crisp4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse Crisp4 Protein, N-His
ARO-P10953-02 100 µg

Recombinant Mouse Crisp4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse Crisp4 Protein, N-His
ARO-P10953-03 1 mg

Recombinant Mouse Crisp4 Protein, N-His

Sign In for Pricing
View Details
PRCC Antibody
orb1326448 100 µg

PRCC Antibody

Sign In for Pricing
View Details
Recombinant Chlorella pyrenoidosa Uncharacterized 12.7 kDa protein in 16S-23S DNA spacer
MBS1032732-01 0.02 mg (E-Coli)

Recombinant Chlorella pyrenoidosa Uncharacterized 12.7 kDa protein in 16S-23S DNA spacer

Sign In for Pricing
View Details